PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000158.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 185aa    MW: 20608.1 Da    PI: 11.0384
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000158.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42e-15104165162
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 +ke kr +r+ +NR++A+  R+RKka++  Le kvk Le++N+++ ++l++l++e + l++ 
  Do000158.1 104 DKEHKRLKRLLRNRVSAQQARERKKAYLTDLEVKVKDLEKKNSEMEERLSTLQNENQMLRQI 165
                 5899*****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.0E-15104168IPR004827Basic-leucine zipper domain
PfamPF001704.5E-14105166IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.289106169IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-16108168No hitNo description
SuperFamilySSF579594.88E-13108166No hitNo description
CDDcd147044.28E-17109160No hitNo description
PROSITE patternPS000360111126IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MQEQAASSRP SSSERSSSSA HHMDMERSSF LIGILLAFRF LFHATMTRME SDEEIRRVPE  60
LGLELPGGAS TSGREAGPGA GGPERAQSST AQASSRRRVR SPADKEHKRL KRLLRNRVSA  120
QQARERKKAY LTDLEVKVKD LEKKNSEMEE RLSTLQNENQ MLRQILKNTT VSRRGPGSTA  180
SGEGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A3e-15129168342Transcription factor HY5
2oqq_B3e-15129168342Transcription factor HY5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0633531e-132BT063353.1 Zea mays full-length cDNA clone ZM_BFc0055M22 mRNA, complete cds.
GenBankKJ7269451e-132KJ726945.1 Zea mays clone pUT3491 bZIP transcription factor (bZIP61) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951525.13e-97PREDICTED: transcription factor HY5-like
SwissprotQ9SM507e-52HY5_SOLLC; Transcription factor HY5
TrEMBLK3YW783e-97K3YW78_SETIT; Uncharacterized protein
STRINGSi018524m1e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.19e-39bZIP family protein